PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa19g057930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family ZF-HD
Protein Properties Length: 251aa    MW: 28031.4 Da    PI: 9.4695
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa19g057930.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.6e-3165119358
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     k+rY+eC+kNhAas Ggh+vDGCgEfm+s geegtaa+l CaAC+CHR+FHR+e +
  Csa19g057930.1  65 KARYRECQKNHAASSGGHVVDGCGEFMSS-GEEGTAASLLCAACDCHRSFHRKEID 119
                     689*************************9.999********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-3953128IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.2E-2966118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.2E-3067118IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.59268117IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466898.96E-17173247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-28177248IPR009057Homeodomain-like
TIGRFAMsTIGR015657.1E-30186243IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MVRSKPSVLD HHRLPPYAYP QTADKDKPTT KRNGSDPDPD LDTNPISIAP APRSYARPQT  60
TSPGKARYRE CQKNHAASSG GHVVDGCGEF MSSGEEGTAA SLLCAACDCH RSFHRKEIDG  120
LFVVNFNSFG HSQRPLVGRH VSPIMMSFGG GGGGGGPAES STEDLNKFHQ SFSGNGVDQF  180
HQFQPKKRFR TKFNEEQKDK MMEFAEKIGW RMTKQEDDEV NRFCREINVK RQVFKVWMHN  240
NKQSAKKKDL *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-201872441875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0064390.0AC006439.4 Arabidopsis thaliana chromosome 2 clone T30D6 map mi39, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010489538.10.0PREDICTED: zinc-finger homeodomain protein 6 isoform X1
RefseqXP_010489539.10.0PREDICTED: zinc-finger homeodomain protein 6 isoform X2
SwissprotQ9ZPW71e-162ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLR0GAP21e-167R0GAP2_9BRAS; Uncharacterized protein
STRINGscaffold_304185.11e-167(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.11e-158homeobox protein 24